Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648287.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
ENGEERRSDRTGSERKRAMAMDNYACLRALLLLLLLSGSVIQVLSLAVGINYGQIANNLPSPSRVAALLRSININRVKLYDADPNVLQAFSNTNVEFIVSVGNEYILNMTDLTKAQDWLK LHIQPYIPQTKITCITVGNEVLSGNDRQLMSNLLPAMQTMHSALVSLGWDKEVYVSTAHSLQILAYSFPPSSGLFRQDLGQYIQPLLNFHSQVNSPFLINAYPYFAYKDNPNEVSLDYVL FRPN | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,369.993 | ||
Theoretical pI: | 6.488 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28880 29005 | ||
Instability index: | 47.836 | ||
aromaticity | 0.090 | ||
GRAVY | -0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.357 | ||
turn | 0.275 | ||
sheet | 0.270 |