Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648306.1	internal	279	2-838(+)
Amino Acid sequence :
FWGTGSRNRMLTYFVPCFYLLNSASLASLTREAGPKVVKGDPARKPETPKVAHVTPHYFTPTISVSDSALKFTHILYNLSPAELYEQAIRYEHGSFITSSGALATLSGAKTGRSPRDKRV VKDATTEEELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPDFTIYNAGQFPCNRYTHYMTSSTSIDLNL ARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSG
Physicochemical properties
Number of amino acids:		279
Molecular weight:		31,797.875
Theoretical pI:		8.651
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41370 41495
Instability index:		44.081
aromaticity		0.111
GRAVY		-0.383
Secondary Structure Fraction
Helix		0.297
turn		0.240
sheet		0.247