Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648327.1 | internal | 238 | 1-714(+) |
Amino Acid sequence : | |||
VFVMFPFMAQGHIIPFLNLALQLEHRTNAQIIFVNTPLNITKLSSSLPENSRIRLTRLPFSPTDHGLPPYSENTDTLPYPLMSLLFHASTSLKPSFHQLISNIITCQQEQLPVDHHRRPR VCIIADMFLGWTVDVANEFNLFHSIYFTCGAYGSAVYFSLWEHLPHRETDSDEFSLPDLPEVGSIHRSQLPYNLQNANGTDSWSLVLRKLLPFWFKTHGILINTVEQELMSQTGLLYL | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 14,418.550 | ||
Theoretical pI: | 8.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 46.736 | ||
aromaticity | 0.075 | ||
GRAVY | 0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.351 | ||
sheet | 0.194 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648327.1 | complete | 134 | 260-664(+) |
Amino Acid sequence : | |||
MPPHPSNPPSINSSPTSSLANRSNYQLITIVVLVFASLQICSWDGPSTSLMNLTYSIPSTSLVARTAPLCISHSGNTSLTAKLIQMSSPFQTCQKLAQFIDLSSLTICKTPMAPTLGHWF FVSCCHFGSKHMGS* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,418.550 | ||
Theoretical pI: | 8.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14355 | ||
Instability index: | 46.736 | ||
aromaticity | 0.075 | ||
GRAVY | 0.193 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.351 | ||
sheet | 0.194 |