Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648328.1 | 5prime_partial | 260 | 1-783(+) |
Amino Acid sequence : | |||
EVLETVIGVADVAWNAMELRHRYNHHREEKREEEEEEEREFKALQSENRLLRAILTENLKLLQKLSESPSLSKDCPLDLYMRLVATVDSADFLHQLETLHQTSSEEPGNSFPFKEVTGPD LQSVETLVDVGINEPSWWVWVVDDKVQPGGEELSGIDNEGYLVIGEEQVVDGVANFVARCIIANPKAQKMTPIELQKTVAKALGGVSKFGTMMKIWEAGKIFYALSTWGLALAGLYRYRA VAKVAAKGIGKSGKLVMRAF* | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 11,994.014 | ||
Theoretical pI: | 9.928 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.066 | ||
aromaticity | 0.140 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.140 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648328.1 | 5prime_partial | 109 | 813-484(-) |
Amino Acid sequence : | |||
FSLIRKRLFPSKCPHDQLSRFSNSFCSYFRNCTVPIQACQSKTPCRQCIEDLPSFPNFHHCAKFAHTTQSFSNSFLQFYWCHLLSFWIGNNASSNKIGNSIHHLFLTNN* | |||
Physicochemical properties | |||
Number of amino acids: | 109 | ||
Molecular weight: | 11,994.014 | ||
Theoretical pI: | 9.928 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.066 | ||
aromaticity | 0.140 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.140 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648328.1 | 3prime_partial | 100 | 300-1(-) |
Amino Acid sequence : | |||
MKRFKLVQEVCRIHSSDKSHIEVERAIFRERRRLRKLLKELEILRKNGSEEAILRLKSLEFTLFLFFFFAFFFSVMIVTVTKFHGVPCNVGDSYHGLQHF | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,994.014 | ||
Theoretical pI: | 9.928 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 49.066 | ||
aromaticity | 0.140 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.400 | ||
turn | 0.140 | ||
sheet | 0.260 |