Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648343.1	5prime_partial	246	3-743(+)
Amino Acid sequence :
GGSGSGDNGYELTDESDFADVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLPYLQAVVKETLRVHPPGPLLSWARLS TSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWVEDSEMPVDLSEQMKLACEMKTPLTA IAIARK*
Physicochemical properties
Number of amino acids:		246
Molecular weight:		19,620.646
Theoretical pI:		10.226
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		54.740
aromaticity		0.060
GRAVY		0.302
Secondary Structure Fraction
Helix		0.304
turn		0.304
sheet		0.245

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648343.1	5prime_partial	184	772-218(-)
Amino Acid sequence :
PLLKSPVPFIYLRAIAIAVRGVFISQANFICSLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIA VVLDGMSIPLPSFTSEVESLAHERRGPGGCTLRVSLTTACRYGRLVTTASVMSWLFATTESSSF*
Physicochemical properties
Number of amino acids:		184
Molecular weight:		19,620.646
Theoretical pI:		10.226
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		8480 8855
Instability index:		54.740
aromaticity		0.060
GRAVY		0.302
Secondary Structure Fraction
Helix		0.304
turn		0.304
sheet		0.245