Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648343.1 | 5prime_partial | 246 | 3-743(+) |
Amino Acid sequence : | |||
GGSGSGDNGYELTDESDFADVLLSLDGEGKLNEEDMISILWEMIFRGTDTMGILTEWIMAELILNPNIQAKLQNELDSVVANNHDITDAVVTNLPYLQAVVKETLRVHPPGPLLSWARLS TSDVKLGNGMLIPSNTTAMVNMWAITHDPNLWEDPMVFKPERFLESEGGVNVDVRGNDLRLAPFGAGRRVCPGKNLGLVTVTMWVAKLVQHFKWVEDSEMPVDLSEQMKLACEMKTPLTA IAIARK* | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 19,620.646 | ||
Theoretical pI: | 10.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 54.740 | ||
aromaticity | 0.060 | ||
GRAVY | 0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.304 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648343.1 | 5prime_partial | 184 | 772-218(-) |
Amino Acid sequence : | |||
PLLKSPVPFIYLRAIAIAVRGVFISQANFICSLRSTGISESSTHLKCCTNLATHMVTVTRPRFLPGHTLRPAPNGASLRSLPLTSTLTPPSLSKNLSGLNTIGSSQRLGSCVIAHMFTIA VVLDGMSIPLPSFTSEVESLAHERRGPGGCTLRVSLTTACRYGRLVTTASVMSWLFATTESSSF* | |||
Physicochemical properties | |||
Number of amino acids: | 184 | ||
Molecular weight: | 19,620.646 | ||
Theoretical pI: | 10.226 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8855 | ||
Instability index: | 54.740 | ||
aromaticity | 0.060 | ||
GRAVY | 0.302 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.304 | ||
sheet | 0.245 |