Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648353.1 | 5prime_partial | 211 | 1-636(+) |
Amino Acid sequence : | |||
PFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYAS LEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHVRNGTPKRPGRPIETYIFAMFNEDRKSPEFEKHFGLFYPSKQPVYPINFA* | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 23,490.336 | ||
Theoretical pI: | 8.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23380 23380 | ||
Instability index: | 46.792 | ||
aromaticity | 0.128 | ||
GRAVY | -0.205 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.318 | ||
sheet | 0.190 |