Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648363.1 | complete | 233 | 75-776(+) |
Amino Acid sequence : | |||
MAVTFSNLNSEAGLKKLDDYLLTRSYITGYQASKDDITVYSALSKAPSSEYVNVCRWYKHIDALLRISGVSDEGQGVNVEDFASAIEEPVATPPVADSKPAADVDDDDDDDVDLFGEETE EEKKAAEERAAAIKASGKKKESGKSSVLLDVKPWDDETDMKKLEEAVRNVHMEGLVWGASKLVPVGFGIKKLQIMLTIVDDLVSIDELIEDYLTAEPANEYIQSCDIVAFNKI* | |||
Physicochemical properties | |||
Number of amino acids: | 233 | ||
Molecular weight: | 12,514.259 | ||
Theoretical pI: | 4.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 73.522 | ||
aromaticity | 0.117 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.383 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648363.1 | complete | 120 | 553-191(-) |
Amino Acid sequence : | |||
MSVSSSHGFTSNSTDDFPDSFFFPDALMAAARSSAAFFSSSVSSPKRSTSSSSSSSTSAAGFESATGGVATGSSIAEAKSSTFTPWPSSETPEILRSASMCLYHRHTFTYSDDGAFERAE * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 12,514.259 | ||
Theoretical pI: | 4.998 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 73.522 | ||
aromaticity | 0.117 | ||
GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
Helix | 0.183 | ||
turn | 0.383 | ||
sheet | 0.225 |