Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648385.1 | internal | 263 | 2-790(+) |
Amino Acid sequence : | |||
TKRPEEIGAGDQGHMFGYATDETPELMPLTHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTIEYLNDHGAMVPVRVHTILISTQHDETVTNDEIAADLKEHVIKPVVPEKYLDEKTIFH LNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVASGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILQIVKENFDFRPGMISIN LDLKRGGNGRYLKTAAYGHFGRE | |||
Physicochemical properties | |||
Number of amino acids: | 263 | ||
Molecular weight: | 14,360.641 | ||
Theoretical pI: | 11.468 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48595 | ||
Instability index: | 46.197 | ||
aromaticity | 0.124 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.318 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648385.1 | 3prime_partial | 129 | 387-1(-) |
Amino Acid sequence : | |||
MTKRPDGFKWKMVFSSKYFSGTTGLMTCSLRSAAISSLVTVSSCWVEMRIVWTRTGTMAPWSFKYSMVTWVLPSGLNHGHVPFLRTSVRRAPSLVARTWVRGISSGVSSVAYPNIWPWSP APISSGRLV | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,360.641 | ||
Theoretical pI: | 11.468 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48595 | ||
Instability index: | 46.197 | ||
aromaticity | 0.124 | ||
GRAVY | 0.126 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.318 | ||
sheet | 0.171 |