Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648386.1	3prime_partial	163	345-833(+)
Amino Acid sequence :
MSSLGVNAYRFSISWTRILPRGRFGDVNHEGIKFYSNLIDYLLLKGIEPFVTIHHFDIPQELEDKYGSWLSPQMQDDFGYYAETCFRSFGERVKYWVTINEPVLFVKLAYHEKKYPPGGY CKILGNCSSSSSSSSSGNNPIMDPMVAIHNMILSHAKATKIYR
Physicochemical properties
Number of amino acids:		163
Molecular weight:		18,675.133
Theoretical pI:		8.376
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		32890 33015
Instability index:		42.019
aromaticity		0.141
GRAVY		-0.271
Secondary Structure Fraction
Helix		0.344
turn		0.288
sheet		0.190