Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648404.1 | internal | 228 | 2-685(+) |
Amino Acid sequence : | |||
CFFFLMLFSGADAHNITRILAEHPEFSTFNHYLTVTHLADEINRKQTITVCAVDNAAMGDLIAKHLTIYSIKKVLALHILLDYFGAKKLHQITNGTALAATMFQATGNAPGSTGFVNITD QKGGKVAFGPEDNDGTLSSTYVKSVKEIPYNISVIQISKILPSPEAEAPTPAPNEVNLTAVMSKQGCKVFSDLLIESGAITTYQQSAIGGLTIFCPTDGVFKDFMPNT | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 24,591.912 | ||
Theoretical pI: | 5.951 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
Instability index: | 38.143 | ||
aromaticity | 0.088 | ||
GRAVY | 0.115 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.232 | ||
sheet | 0.241 |