Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648424.1	3prime_partial	237	54-764(+)
Amino Acid sequence :
MEKALNRQQVLLQHLRPSASLSQLGDESAISASICLAGDSSAYQRTSVFGDDVVIVAAYRTPICKSRRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMA AFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKD
Physicochemical properties
Number of amino acids:		237
Molecular weight:		25,124.146
Theoretical pI:		6.156
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13200
Instability index:		41.165
aromaticity		0.055
GRAVY		-0.096
Secondary Structure Fraction
Helix		0.262
turn		0.219
sheet		0.274