Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648427.1 | internal | 264 | 1-792(+) |
Amino Acid sequence : | |||
KETVKKSAMDSDYGVPRELSDLQKHRTLYEPELPPCLQGTTVRVEFGDTTTAADPFGARTISRSFPHTYGQPLAHFLRATAKVPDAQIITEHPAIRVGVVFCGRQSPGGHNVIWGIHNAL KIHNPDNELLGFLGGTEGLFVQKTLKITDEVLSTYKNQGGYDLLGRTQDQIRTTEQVKAALNTCKALKLDGLVIIGGVTSNTDAAQLAETFAEAKCSTKVVGVPVTLNGDLKNQFVEANV GFDTICKVNSQLISNVCTDALSAE | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 28,507.987 | ||
Theoretical pI: | 6.191 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
Instability index: | 27.977 | ||
aromaticity | 0.061 | ||
GRAVY | -0.204 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.223 | ||
sheet | 0.231 |