Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648432.1	internal	266	2-799(+)
Amino Acid sequence :
ADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQVHNSWLFFPWHRYYLYFYERILGKLI DDPSFAIPYWNWDSSTGMVLPEFYADLKSPLYDSLRDAKHQPPTLVDLDYNLVDPNVSREQQITSNLTIMYRQMVSNAKTSLLFLGSPYRAGDEPDPGAGSMENIPHGPVHLWTGDRTQP NVENMGNFYSAARDPIFYSHHSNIDR
Physicochemical properties
Number of amino acids:		266
Molecular weight:		30,270.693
Theoretical pI:		5.179
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		51340 51590
Instability index:		44.515
aromaticity		0.124
GRAVY		-0.492
Secondary Structure Fraction
Helix		0.301
turn		0.267
sheet		0.222