Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648458.1	internal	268	1-804(+)
Amino Acid sequence :
WSLQARMDRYKIIKEVGDGTFGSVWRAINKQTGEVVAIKKMKRKYYSWEECINLREVKMNHPNIVQLKEVIRENDILYFVFEYMECNLYQLMKDRGKLFSEAEVRNWCFQVFQGLAYMHQ RGYFHRDLKPENLLVTKDLIKIADFGLAREISSQPPYTEYVSTRWYRAPEVLLQSSIYSSAVDMWAMGAIMAELFTLRPLFPGSSEADEIYKICSVIGTPTQNSWPQGLQLANGIKCQFP QFTSVHLSVLIPSASEDAIDLITVKYHS
Physicochemical properties
Number of amino acids:		268
Molecular weight:		31,123.561
Theoretical pI:		7.759
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		59360 59610
Instability index:		41.057
aromaticity		0.123
GRAVY		-0.222
Secondary Structure Fraction
Helix		0.351
turn		0.201
sheet		0.250