Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648471.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
SPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPI REAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALV DSVYASLEKA | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,719.448 | ||
Theoretical pI: | 8.963 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 46.306 | ||
aromaticity | 0.100 | ||
GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.288 | ||
sheet | 0.220 |