Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648474.1 | 5prime_partial | 265 | 1-798(+) |
Amino Acid sequence : | |||
RMRSSWVLIVLPLISLVGVALAQDLTSLISEATFNEMLKHRGEGNCRGGFYTYNAFITAARSFNGFATTGSPDDRKKEIAAFFGQTSHETTGGWPAAPDGPFAWGYCFVEEQGNPGALCQ PSPQWPCAPGKKYYGRGPIQISWNFNYGQAGRAIGVDLINNPELVARDPVISFKTALWFWMTPQSPKPSCHDVILGRWRPSAADQAAGRVPGYGVITNIINGGIECGKGQNPQVENRIGF YRRYCSMLGVNPGGNLDCYNQRPFA* | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 11,029.598 | ||
Theoretical pI: | 11.120 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 63.694 | ||
aromaticity | 0.010 | ||
GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.240 | ||
sheet | 0.320 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648474.1 | 5prime_partial | 114 | 834-490(-) |
Amino Acid sequence : | |||
INQTNGILRAFKLSKRPLIIAIEVATRVHTQHAAVSPVESYPVLHLRVLTLPTFYTSIYDIGDDSIARNPTRSLVRSRWSPSPKDHIVARGLGRLWSHPEPQSRFEGDDWISGY* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 11,029.598 | ||
Theoretical pI: | 11.120 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 63.694 | ||
aromaticity | 0.010 | ||
GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.240 | ||
sheet | 0.320 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648474.1 | complete | 100 | 191-493(+) |
Amino Acid sequence : | |||
MALLPLAAPTIVRRRSQLSLAKRPMKLLEGGLLHLTDHLHGVTASLKNRAIPELSVNRVLSGPVRQARNITAEDRSRFHGTSITDKREEPLELTSSTTQS* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,029.598 | ||
Theoretical pI: | 11.120 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 63.694 | ||
aromaticity | 0.010 | ||
GRAVY | -0.355 | ||
Secondary Structure Fraction | |||
Helix | 0.260 | ||
turn | 0.240 | ||
sheet | 0.320 |