Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648482.1 | internal | 262 | 3-788(+) |
Amino Acid sequence : | |||
LSNHSKMPSTFFKFNSLIRLQCLFLIFLSASSSPPEDPIKRSSSSSSSSTFTNCTITNAYGIFPDRSICRAGTAVFPSSESELLEAVAEASKKNKKMKVATRYSHSIPKLICPDGDEGLL ISTKNLNKVLMVDPSTMVMRVESGVTLKQLIEEAAKAGLALPYAPYWWGLTVGGLLGTGAHGSSLWGKGSSVHEYVEEIRIVTVAGPNEGYAKIRVVGQNDPDMDAVKVALGVLGVISQV TFKLQPIFKRSFTNLVKDDSDL | |||
Physicochemical properties | |||
Number of amino acids: | 262 | ||
Molecular weight: | 13,082.948 | ||
Theoretical pI: | 11.414 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 83.721 | ||
aromaticity | 0.145 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.227 | ||
sheet | 0.173 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648482.1 | complete | 110 | 581-249(-) |
Amino Acid sequence : | |||
MHGAPFAPQRAPMSTGSQQPSHGQSPPVRRIRQRKPSFCSFFYQLLQRYTTLHSHHHRRWIHHQHLVQILGAYKQPFVPVWAYQLWNAVRISSCHFHLLVLLRGFGYRFE* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 13,082.948 | ||
Theoretical pI: | 11.414 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 83.721 | ||
aromaticity | 0.145 | ||
GRAVY | -0.455 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.227 | ||
sheet | 0.173 |