Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648499.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
APVGPPQPLEWKFSQVFGERTAGEEVQEVDIISAIEFDKTGDHLATGDRGGRVVLFERTDTKDHGYRRDLEKMDYPVSRHPEFRYKTEFQSHEPEFDYLKSLEIEEKINKIRWCQMANGA LFLLSTNDKTIKFWKVQEKKVKKICDMNIDSSKTVGNGSIAGSSISTSTKSYRANGECSERAYNCLSNDFSFPPGGIQSLRLPVVVTSHETS | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 24,005.642 | ||
Theoretical pI: | 6.018 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25690 | ||
Instability index: | 43.458 | ||
aromaticity | 0.094 | ||
GRAVY | -0.667 | ||
Secondary Structure Fraction | |||
Helix | 0.269 | ||
turn | 0.250 | ||
sheet | 0.203 |