Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648509.1 | internal | 248 | 1-744(+) |
Amino Acid sequence : | |||
PMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIR EAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVD SVYASLEK | |||
Physicochemical properties | |||
Number of amino acids: | 248 | ||
Molecular weight: | 27,561.293 | ||
Theoretical pI: | 9.008 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 44.827 | ||
aromaticity | 0.101 | ||
GRAVY | -0.016 | ||
Secondary Structure Fraction | |||
Helix | 0.367 | ||
turn | 0.286 | ||
sheet | 0.218 |