Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648512.1 | internal | 236 | 1-708(+) |
Amino Acid sequence : | |||
VLCDQLSVSSTMSLLDDLMNLSLSETTEKIIAEYIWIGGSGMDMRSKGRTLPAPVTEPHKIPKWNYDGSSTGQAPGEDSEVILYPQAVFKDPFRKENNILVMCDAYTPQGDPIPTNKRYN AAKIFSHPDVAAEEPWYGIEQEYTLLQKDVKWPLGWPVGGFPGPQGPYYCGVGADKAFGRDIVDAHYKACLYAGINISGINGEVMPGQWEFQVGPSVGISSGDQVWVARYILERIA | |||
Physicochemical properties | |||
Number of amino acids: | 236 | ||
Molecular weight: | 25,995.136 | ||
Theoretical pI: | 4.755 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56380 56630 | ||
Instability index: | 47.459 | ||
aromaticity | 0.106 | ||
GRAVY | -0.278 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.284 | ||
sheet | 0.216 |