Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648516.1 | internal | 252 | 3-758(+) |
Amino Acid sequence : | |||
LSLSASVSASSLTQKKPLQGAKTPAIPNRCGSKQARFISCEKKQGGEHGHENHVIDRRNVLLGIGGLYGATATIGSQGKVAIGAPVQPPDLSKCHLALDSDAGQEVNCCPPYSTANIIDF VPPSHDERLRRRKPAHMLNPEEIEKFKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMPEFY LDKMSPLYNDNR | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 28,361.013 | ||
Theoretical pI: | 7.753 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46410 46785 | ||
Instability index: | 50.224 | ||
aromaticity | 0.099 | ||
GRAVY | -0.471 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.258 | ||
sheet | 0.234 |