Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648530.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
NLTQKDLQLIASSVVLAALSVSPYDHMHGASHMELEKEKERNWRMASLIGFSLDPKRESREELSRAALLSELVSKGVMSCVSQEVKDLYNILEHEFLPLDLSSRVQPLLTKISKLGGKVV SASSLPEVQLSQYVPAMEKLACLRVLQQVSQVYQTMKIDVLSKMIPFFAFSAVEKLSVDAIKYNFISMKVDHLKGVVVFGSLDLESDKVRDHLTVLAECLNKARSLIYPPIKKASKLSET LPSLAETIDKEHKRLLARKSIIERR | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 29,760.485 | ||
Theoretical pI: | 8.973 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 49.308 | ||
aromaticity | 0.053 | ||
GRAVY | -0.053 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.204 | ||
sheet | 0.321 |