Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648533.1 | 3prime_partial | 264 | 40-831(+) |
Amino Acid sequence : | |||
MAVSSYCSRVFPPAFECRSDPDFSGNPRPEKASFGQFSYRKVPICGSVGGSGGLSSLIFRFPPNFVRQLSTKARRNCSNIGVAQVVAASWSNNNNSSSSSNNNNNNVPAVPNVVAAAAVD APAVIDLTNDEAASVDDGVYCNNSSGVVQFSGSAALKASFLRSDGSVAIHAGERLGRGIVTDGITTPVVNTTAYFFKTSDELIDFKEGRHASFEYGRYGNPTTVVAEEKISALEGAESTI FMASGMCASTVLLFALVPRGGHIV | |||
Physicochemical properties | |||
Number of amino acids: | 264 | ||
Molecular weight: | 27,712.587 | ||
Theoretical pI: | 6.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14815 | ||
Instability index: | 31.595 | ||
aromaticity | 0.087 | ||
GRAVY | -0.040 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.345 | ||
sheet | 0.208 |