Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648536.1 | internal | 265 | 2-796(+) |
Amino Acid sequence : | |||
FFEVTHDISNLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPRGFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHPESLHMFTFLFDDI GVPQDYRHMEGSGVNTYTLINKAGKAYYVKFHWKPTCGVKSLLEDEAIKVGGANHSHATQDLYDSIAAGNYPEWKLFIQTIDPDHEDRFDFDPLDVTKTWPEDILPLQPVGRLVLNRNID NFFAENEQLAFCPGIIVPGVYYSDD | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 30,413.922 | ||
Theoretical pI: | 5.303 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35410 35535 | ||
Instability index: | 30.811 | ||
aromaticity | 0.136 | ||
GRAVY | -0.326 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.230 | ||
sheet | 0.189 |