Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648544.1 | internal | 244 | 2-733(+) |
Amino Acid sequence : | |||
GRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRYKHQKELFIAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVEHHVG DRGVLARASGDYAIVISHNPDNGTTRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAAR RTGR | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 11,702.164 | ||
Theoretical pI: | 5.661 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 44.164 | ||
aromaticity | 0.057 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.248 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648544.1 | 5prime_partial | 115 | 733-386(-) |
Amino Acid sequence : | |||
TTRSPGSNETNLLTRRGIPANGTGMANVLVVSSSMGMLYRIHSHTTNLGPAVSLHSVFVICVSSLKHWFLSSTSSCNLPNHCSASAWHNLLCTRRKFDPGGSIIGIMADNDGVIS* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 11,702.164 | ||
Theoretical pI: | 5.661 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 44.164 | ||
aromaticity | 0.057 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.248 | ||
sheet | 0.333 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648544.1 | complete | 105 | 355-38(-) |
Amino Acid sequence : | |||
MMLNITNYSSLGNRSEGKHVTDHQIGLLSTIHELASVHAFGGNEKLLLMLVPERMPESHTRQRSASTWIVNDLRNNAFQVAISFAEIEAPEASWTLAMVRVGLED* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,702.164 | ||
Theoretical pI: | 5.661 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12490 | ||
Instability index: | 44.164 | ||
aromaticity | 0.057 | ||
GRAVY | -0.135 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.248 | ||
sheet | 0.333 |