Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648559.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
LAFKTKTIEFFAEEEEEEPDSLTLLDSAEEIITGQRVVVIKPDAVQHKPSSATEPALDDLKQALISSLFATISSFEASYLQLQTAHSPFDADNIEAADKAAVSHLQKLSEIRNWYRDLDK NPNPNPMFTSSFPVGSHLEAQVQENQSLLRTLDLLVNRLQAEIDVKDAEVLMMKQKLRKIEESNSKLSKRLSDSKTNSSSNSDSEVLLSVRVFESVLRYACKWVHRFTKLLIHLMKKVGW DLDLVANSVHPDVAYAKIGHNRYAFLSYVCL | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,592.369 | ||
Theoretical pI: | 5.541 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 53.830 | ||
aromaticity | 0.074 | ||
GRAVY | -0.287 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.207 | ||
sheet | 0.303 |