Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648580.1 | internal | 247 | 2-742(+) |
Amino Acid sequence : | |||
LKFAKQKGGRLVVLDEENRRDIVVPGGSTVIRGVSKDIRCDKGDRIRYKSDVLEFNQMSELLNQKSSVQGKVPSGFFNAIFELSGAWLNDATDSKYLAFDGYFISLYSLHLTTSPLVLQE KVKKAVPSNWDPALLSRFIHTYGTHIIVGMGVGGQDVICVRQKPSSSIPPAELKAHFEYLGDSWFSDGRMLSPNEMKSRDAKQKVPEIFHQIFQSNTMQLSSVTETSSKDGLTIVCSKRG GNVYLHS | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 27,494.053 | ||
Theoretical pI: | 9.023 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 39.452 | ||
aromaticity | 0.089 | ||
GRAVY | -0.301 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.271 | ||
sheet | 0.194 |