| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JG648582.1 | internal | 243 | 1-729(+) |
Amino Acid sequence : | |||
| DQTMGRVIRAQRKGAGSVFKSHTHHRKGPARFRSLDFGERNGYLKGVVTEIIHDPGRGAPLARVTFRHPFRYKHQKELFIAAEGMYTGQFVYCGKKANLMVGNVLPLRSIPEGAVVCNVE HHVGDRGVLARASGDYAIVISHNPDNGTTRIKLPSGAKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVRGVAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKGWS HCC | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 11,456.410 | ||
| Theoretical pI: | 9.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 115.796 | ||
| aromaticity | 0.089 | ||
| GRAVY | -1.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.337 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JG648582.1 | 5prime_partial | 110 | 729-397(-) |
Amino Acid sequence : | |||
| AAMRPTLLTRRGIPANGTGMANVLVVSSSMGMLYRIHSHTTNLGPAVSLHSVFVICVSSLKHWFLSSTSSCNLPNHCSASAWHNLLCTRRKFDPGGSIIGIMADNDGVIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,456.410 | ||
| Theoretical pI: | 9.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 115.796 | ||
| aromaticity | 0.089 | ||
| GRAVY | -1.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.337 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JG648582.1 | complete | 105 | 366-49(-) |
Amino Acid sequence : | |||
| MMLNITNYSSLGNRSEGKHVTDHQIGLLSTIHELASVHAFGGNEKLLLMLVPERMPESHTRQRSASTWIVNDLRNNAFQVAISFAEIEAPEASWTLAMVRVGLED* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,456.410 | ||
| Theoretical pI: | 9.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 115.796 | ||
| aromaticity | 0.089 | ||
| GRAVY | -1.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.337 | ||
| sheet | 0.158 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >JG648582.1 | 5prime_partial | 101 | 3-308(+) |
Amino Acid sequence : | |||
| SDDGASHQSSEEGSWFSLQVPHAPSQGSSSLPEPRFRRTKWLPERRCYGDHSRSRSRRSSGACDFPASVPVQASEGAFHCRRRHVHWPVRVLWKEGQSDGR* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,456.410 | ||
| Theoretical pI: | 9.862 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
| Instability index: | 115.796 | ||
| aromaticity | 0.089 | ||
| GRAVY | -1.110 | ||
Secondary Structure Fraction | |||
| Helix | 0.188 | ||
| turn | 0.337 | ||
| sheet | 0.158 | ||