Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648603.1 | internal | 270 | 2-811(+) |
Amino Acid sequence : | |||
TNVSSQIFRQIPELRVDLRRLRAAKFAGISFPPIRLSRNRCSRSPATRLKWAPRLSLAERSPATSPEVDVNGLVDFLYEDLAHLFDDQGIDPTMYDEEVKFRDPITKHDTISGYLFNIKL LRILFRPDFQLHFVKQTGPYEITTRWTMTMKFILLPWKPELVFTGISIMGVNPKTQKFCSHLDLWDSISNNEYFSFEGLWDVIRQLRMYKTPDLETPKYQILKRTADYEVRKYSPFVVAE AKGETLSGSRGFNDVAGYIFGKNSSEEKIP | |||
Physicochemical properties | |||
Number of amino acids: | 270 | ||
Molecular weight: | 31,343.600 | ||
Theoretical pI: | 9.079 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
Instability index: | 43.298 | ||
aromaticity | 0.122 | ||
GRAVY | -0.381 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.222 | ||
sheet | 0.219 |