Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648622.1 | internal | 247 | 1-741(+) |
Amino Acid sequence : | |||
GVNKENVVSSVATVPVVTLNSGHKMPVLGTGTASFPVPPLEELKKVIMEAMEVGYRHFDTAAMYQSEEGLGAAIKEALEKGLIKSRDELFITTKLWCNNAQPHLVLPAIHESLRRLRLEY VDLYLIHYPVGLKEDLLSMDCKEDEIFPIDIKSVWSAMEEIHNLGLAKSIGVSNFTCKKLTDLLAHAKVPPAVNQVEMHPAWQQKKLREFCQEKGIQVSAYSPLGAKQWGFDVVLSNKII KEIAHHK | |||
Physicochemical properties | |||
Number of amino acids: | 247 | ||
Molecular weight: | 27,591.781 | ||
Theoretical pI: | 6.593 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
Instability index: | 48.206 | ||
aromaticity | 0.069 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.328 | ||
turn | 0.206 | ||
sheet | 0.300 |