Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648629.1 | internal | 290 | 1-870(+) |
Amino Acid sequence : | |||
FMATFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIK YIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANN LVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNART | |||
Physicochemical properties | |||
Number of amino acids: | 290 | ||
Molecular weight: | 31,724.785 | ||
Theoretical pI: | 8.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31860 31860 | ||
Instability index: | 47.829 | ||
aromaticity | 0.100 | ||
GRAVY | -0.012 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.300 | ||
sheet | 0.217 |