Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648643.1	5prime_partial	289	3-872(+)
Amino Acid sequence :
NIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSR GVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLEIVVSESGWPSAGGTATSIDNARTYNQNLINHV RNGTPKRPGRPIETYIFAMFNEDRKSPEFEKHFGLFYPSKQPVYPINFA*
Physicochemical properties
Number of amino acids:		289
Molecular weight:		32,264.161
Theoretical pI:		8.963
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		34840 34840
Instability index:		49.367
aromaticity		0.114
GRAVY		-0.257
Secondary Structure Fraction
Helix		0.339
turn		0.315
sheet		0.187