Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648678.1 | internal | 281 | 3-845(+) |
Amino Acid sequence : | |||
FISLAIPFSAMASLPLLSMVLCFLSLSMKVSYAALPSELYWQSLLPNTPIPKAVQDLLPPAGKINKPASIGVQPTSIPQYARYASEEQLRQKDYSYFFLEKDFHPGTKLNLHFTKTTTET AFLPRKVAESIPFSSTKLPDILNRFSVKPGSREAEVIKQTIEDCESPAIQGEDRYCATSLESMVDYCAAKLGKNAKVVATKVNDDKITPKQQYTIEEGVKEMGGDKSMVCHNQNYAYAVF YCHLTLKTKAYLVPLVGADDTKVNAVAVCHSDTSKWNPGTW | |||
Physicochemical properties | |||
Number of amino acids: | 281 | ||
Molecular weight: | 11,680.775 | ||
Theoretical pI: | 9.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 30.412 | ||
aromaticity | 0.099 | ||
GRAVY | 0.507 | ||
Secondary Structure Fraction | |||
Helix | 0.416 | ||
turn | 0.198 | ||
sheet | 0.228 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648678.1 | 5prime_partial | 101 | 845-540(-) |
Amino Acid sequence : | |||
PGAWIPFRSIRMANGNSVHFSVVSTNQWYQISLCLKREMAVKHSIRIVLIMAHHRLITAHLFNTFFDCILLLRCDLIIINLCGHHLSIFPELRSTIVYHGL* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,680.775 | ||
Theoretical pI: | 9.513 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 30.412 | ||
aromaticity | 0.099 | ||
GRAVY | 0.507 | ||
Secondary Structure Fraction | |||
Helix | 0.416 | ||
turn | 0.198 | ||
sheet | 0.228 |