Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648679.1	3prime_partial	240	42-761(+)
Amino Acid sequence :
MAAISGVGLCLGSKLSQRPHWPSTATTVTSSRSCRRGLSPQIKMAVTVEKKEFTLQKSQEIFDAAKDLMPGGVNSPVRAFKSVGGQPIVFDSVKGSHMWDVDGNEYIDYVGSWGPAIIGH ADDEVLAALAETMKKGTSFGAPCVLENELAKMVISAVPSIEMVRFVNSGTEACMSVIRLARAFTEREKIIKFEGCYHGHGNSFLVKAGSGVATLGLPDSPGVPKAATASTLTSPFNDFQT
Physicochemical properties
Number of amino acids:		240
Molecular weight:		11,685.070
Theoretical pI:		8.901
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17335
Instability index:		65.843
aromaticity		0.126
GRAVY		-0.307
Secondary Structure Fraction
Helix		0.291
turn		0.223
sheet		0.175

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648679.1	5prime_partial	103	2-313(+)
Amino Acid sequence :
FVLRRRTGVGLRTDGSDIRCWTVLGIEAVAEASLAVYCYDGYKFSIMSSRFVSADQNGGNGGEERIHASEVPRDFRRRQGFDARRCQFSCPCVQICRWATYSF*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,685.070
Theoretical pI:		8.901
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		16960 17335
Instability index:		65.843
aromaticity		0.126
GRAVY		-0.307
Secondary Structure Fraction
Helix		0.291
turn		0.223
sheet		0.175