Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648680.1 | internal | 260 | 3-782(+) |
Amino Acid sequence : | |||
TWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLLGAKEIAVRAWDQTLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLVFEHPTLAGNQSGGWMARQKHLETSEAQPTMKKSV STPFMNTSAKTFSTSEVKKHNTAESCWIIVHGHVYDCTSFLKDHPGGADSILINAGTDCTEEFDAIHSDKAKKMLEDYRIGELITTGYTSDSSTSSPNNSVHGASSLNHLAPIKEIVPIR LPALIPREKIPCKLVSKTSI | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 29,191.107 | ||
Theoretical pI: | 6.796 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 56950 57450 | ||
Instability index: | 35.459 | ||
aromaticity | 0.081 | ||
GRAVY | -0.378 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.246 | ||
sheet | 0.231 |