Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648721.1 | internal | 280 | 1-840(+) |
Amino Acid sequence : | |||
ISTTVLKPFSIQTLPFSKKSFSITLSVSLNPPTQTSESEEEVVIGDCVVFEEGAFEDPYLQQNEELVSDNSNNKPIRRKVIKKAEEAEQESLVPGKWAEAVAEYNISKKERRRIMQQIEQ GSRIERKNRAIPVKNTQEFLSYREFKLAQLKPRVLDDPEYYDDEVEGEVGGVELECSSSAGRVVGKNPRLEVYGRGLEDISEFFTSGDYVPVEKKSAGPRKLFTKEEKVLLNKRVPHLAD ATSEKWLPLHTLAASGEFYLVDALLKHNVDINAADRDGLT | |||
Physicochemical properties | |||
Number of amino acids: | 280 | ||
Molecular weight: | 31,578.168 | ||
Theoretical pI: | 5.173 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 44.095 | ||
aromaticity | 0.075 | ||
GRAVY | -0.581 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.232 | ||
sheet | 0.275 |