Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648728.1 | internal | 268 | 3-806(+) |
Amino Acid sequence : | |||
LIEVDRVLRPGGYWVLSGPPIHWKKYWRGWERSQEDLKQEQDAIENVAKRLCWNKVIEKDDLSIWQKPMNHIECKKSREIYHTPHICKSQDADAAWYSNLETCITPLPEVSSTDEVAGGA LEKWPERAFAIPPRISSGSIAGITAEKFLEDNKLWKERVQRYKHIIPTLNRGRYRNVMDMNAYLGGFAAALLKYPVWVMNVVPSGSDQDTLGVIYERGFIGTYQDWCEAFSTYPRTYDLI HAANVFSIYQDRCDITYILLEMDRILRP | |||
Physicochemical properties | |||
Number of amino acids: | 268 | ||
Molecular weight: | 12,992.848 | ||
Theoretical pI: | 6.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 51.609 | ||
aromaticity | 0.061 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.246 | ||
sheet | 0.140 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648728.1 | 5prime_partial | 114 | 806-462(-) |
Amino Acid sequence : | |||
WPQYPIHLQQNICDVTPILIYTEHVGRMNQIISSWVCGERLTPILIGPNESTLVDNTEGVLVRTGRHNVHYPDRIFQQSSCKSPKVSIHVHHITIPTTVKGWDDMLVTLHPLLP* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,992.848 | ||
Theoretical pI: | 6.758 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
Instability index: | 51.609 | ||
aromaticity | 0.061 | ||
GRAVY | -0.132 | ||
Secondary Structure Fraction | |||
Helix | 0.351 | ||
turn | 0.246 | ||
sheet | 0.140 |