Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648776.1 | internal | 151 | 2-454(+) |
Amino Acid sequence : | |||
PCSSINLALGFPPPWPKIRSRASLLLTKAAIAVEQQTKTNVSLIKIGTRGSPLALAQAYETRDKLMATHSELAEEGAIEIVIIKTTGDKILDQPLADIGGKGLFTKEIDEALLNGEVDIA VHSMKDVPTYLPEGTILPCNLPREDVRDAFI | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,300.682 | ||
Theoretical pI: | 5.198 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 31.335 | ||
aromaticity | 0.040 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.219 | ||
sheet | 0.305 |