Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648782.1 | internal | 148 | 1-444(+) |
Amino Acid sequence : | |||
CKFGLYEYFKKIYSDSFVDQHKSLIFFLSSASAQVFADVTLCPFEAIKVRVQAQPSFAKGLVDGFPRLYAAEGFSGFYKGLLPLWGRNLPFSIFMFSTFEYSVDSIYRKVIQRRKEDCSK TQQLAVTCAAGYAAGAIGTFVSNPADNI | |||
Physicochemical properties | |||
Number of amino acids: | 148 | ||
Molecular weight: | 16,539.809 | ||
Theoretical pI: | 8.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17670 | ||
Instability index: | 30.499 | ||
aromaticity | 0.169 | ||
GRAVY | 0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.365 | ||
turn | 0.223 | ||
sheet | 0.216 |