Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648787.1	3prime_partial	180	542-3(-)
Amino Acid sequence :
MHGQEIPFVPRKTNITTPKATLRTGLSWAIMQLIRLSSISQDPEKITGLVLPPRRDQCPATHVRIRSLINGPVCGRLRASRCGSHKADREVARFPYNSLIGDEWEEGDWKTVGRSNCLAL QPNVQWARTVWSNQGQARSINPGSTSAYDIVLGSGSKRSSCRVEHRTGQALGKRSQSVNG
Physicochemical properties
Number of amino acids:		180
Molecular weight:		19,548.865
Theoretical pI:		8.314
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13325
Instability index:		49.422
aromaticity		0.072
GRAVY		-0.254
Secondary Structure Fraction
Helix		0.272
turn		0.294
sheet		0.206

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648787.1	internal	180	3-542(+)
Amino Acid sequence :
AINALATLAQGLPRAVLDPAGRPLRTGTQYYIIRRSAPGINGPGLTLVRPNGSCPLYVGLQGKTIGSSNGLPVTFLPFVSDETVIRESSDFSVSFVASTTTCPESTTDWAIDQASDPNMS GRTLITTRRENQPSDFFRILRDGRETYKLHYCPTEACPQCRFRCGDIGLSRNEGNLLAVH
Physicochemical properties
Number of amino acids:		180
Molecular weight:		19,548.865
Theoretical pI:		8.314
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12950 13325
Instability index:		49.422
aromaticity		0.072
GRAVY		-0.254
Secondary Structure Fraction
Helix		0.272
turn		0.294
sheet		0.206