Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648792.1 | internal | 164 | 1-492(+) |
Amino Acid sequence : | |||
KMSLNLAATSSLFVFFFLLVSVPAEDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLPEPFLLSWNGVQQRRNSWQDGVYGTTCPIPPGKNFTYTLQVKD QIGSFFYFPSLAFHKAAGGFGGLRILSRPRIPVPFPEPAGDYTL | |||
Physicochemical properties | |||
Number of amino acids: | 164 | ||
Molecular weight: | 18,381.766 | ||
Theoretical pI: | 8.066 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
Instability index: | 53.629 | ||
aromaticity | 0.159 | ||
GRAVY | 0.008 | ||
Secondary Structure Fraction | |||
Helix | 0.384 | ||
turn | 0.323 | ||
sheet | 0.165 |