Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648796.1 | internal | 251 | 3-755(+) |
Amino Acid sequence : | |||
VLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSE NVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPVATKLVDPKTGDEKPIVVSVDDGIRPSTNLKDLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAMRKGLPILGVFR SFAAVGVDPAV | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 11,255.065 | ||
Theoretical pI: | 11.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 40.498 | ||
aromaticity | 0.091 | ||
GRAVY | 0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.318 | ||
sheet | 0.300 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648796.1 | 5prime_partial | 110 | 754-422(-) |
Amino Acid sequence : | |||
TAGSTPTAAKLLNTPSIGSPFLIARLLFIKRTAPAPSLTWLALPAVVVPSFLNAGLSFAKSFKFVLGRIPSSTDTTMGFSSPVFGSTNLVATGMISSLNLPDAVAAAAFL* | |||
Physicochemical properties | |||
Number of amino acids: | 110 | ||
Molecular weight: | 11,255.065 | ||
Theoretical pI: | 11.069 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 40.498 | ||
aromaticity | 0.091 | ||
GRAVY | 0.709 | ||
Secondary Structure Fraction | |||
Helix | 0.336 | ||
turn | 0.318 | ||
sheet | 0.300 |