Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648799.1 | internal | 165 | 1-495(+) |
Amino Acid sequence : | |||
EDNRPEAVLDVAGNKVQSGLKYHILPVLRGRFGGLTLAPNRNGSCPFDVVQDRNPRSNGLPLTFSPVDNDGIVRTITDQNIEFSEASTICAQSTVWKLADVDESIRKSIITTGGTRGNPG RETLSNWFKIEKYEDHYKLVFCPSVCIVCSVLCDDIGVYMDNGVS | |||
Physicochemical properties | |||
Number of amino acids: | 165 | ||
Molecular weight: | 11,640.222 | ||
Theoretical pI: | 10.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.881 | ||
aromaticity | 0.058 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.282 | ||
sheet | 0.155 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648799.1 | 5prime_partial | 103 | 495-184(-) |
Amino Acid sequence : | |||
RHSIIHINTNIITKHTANNADRRAKNKLVVIFIFLNLKPIAQSFTARIPSSPSSCDNRLSNRFINICKLPNRRLRANGGSFRELDVLVSDGADDSVVIDWRKS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,640.222 | ||
Theoretical pI: | 10.864 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 55.881 | ||
aromaticity | 0.058 | ||
GRAVY | -0.305 | ||
Secondary Structure Fraction | |||
Helix | 0.311 | ||
turn | 0.282 | ||
sheet | 0.155 |