Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648799.1	internal	165	1-495(+)
Amino Acid sequence :
EDNRPEAVLDVAGNKVQSGLKYHILPVLRGRFGGLTLAPNRNGSCPFDVVQDRNPRSNGLPLTFSPVDNDGIVRTITDQNIEFSEASTICAQSTVWKLADVDESIRKSIITTGGTRGNPG RETLSNWFKIEKYEDHYKLVFCPSVCIVCSVLCDDIGVYMDNGVS
Physicochemical properties
Number of amino acids:		165
Molecular weight:		11,640.222
Theoretical pI:		10.864
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		55.881
aromaticity		0.058
GRAVY		-0.305
Secondary Structure Fraction
Helix		0.311
turn		0.282
sheet		0.155

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648799.1	5prime_partial	103	495-184(-)
Amino Acid sequence :
RHSIIHINTNIITKHTANNADRRAKNKLVVIFIFLNLKPIAQSFTARIPSSPSSCDNRLSNRFINICKLPNRRLRANGGSFRELDVLVSDGADDSVVIDWRKS*
Physicochemical properties
Number of amino acids:		103
Molecular weight:		11,640.222
Theoretical pI:		10.864
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5500 5625
Instability index:		55.881
aromaticity		0.058
GRAVY		-0.305
Secondary Structure Fraction
Helix		0.311
turn		0.282
sheet		0.155