Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648809.1 | internal | 130 | 3-392(+) |
Amino Acid sequence : | |||
FYLRRLWGEPSEDLKKKPKYLVTFTVGINQKNNINAAVKKFPEDDFTILLFHYDGQTSEWDQFEWSKRAVHVSVRRQTKWWYAKRFLHPDVVAAYDYIFIWDEDLGVEHFNAAKYIQLVK KHGLEISQPG | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 15,551.491 | ||
Theoretical pI: | 8.748 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43430 | ||
Instability index: | 51.290 | ||
aromaticity | 0.169 | ||
GRAVY | -0.562 | ||
Secondary Structure Fraction | |||
Helix | 0.377 | ||
turn | 0.162 | ||
sheet | 0.200 |