Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648817.1 | 5prime_partial | 112 | 3-341(+) |
Amino Acid sequence : | |||
DLYDISLIDGFNVPVELSPVTTTATCRSVRCAADITAECPAQLRVPGGCNHPCNVFKSDEYCCNSGSVCVPTNYSRFFKSRCPEAYSFPTPDGPTSTLVCAGGTNYRVVFCP* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,044.505 | ||
Theoretical pI: | 5.149 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 8075 | ||
Instability index: | 38.477 | ||
aromaticity | 0.098 | ||
GRAVY | -0.034 | ||
Secondary Structure Fraction | |||
Helix | 0.268 | ||
turn | 0.304 | ||
sheet | 0.143 |