Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648822.1	internal	132	1-396(+)
Amino Acid sequence :
SPARFFKAAVLHMHELAEKIMPAVVKKGALVEGDGCVGSIKEYHFTEAIPFKHVRERVEELDKEGHACKYSVIEGGTLGIYYKSATNKVKIEAGANGGSVIKLEGEIHELDGVAYPEEEK LKTKEGSLATYK
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,902.452
Theoretical pI:		8.873
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3480
Instability index:		30.695
aromaticity		0.114
GRAVY		0.368
Secondary Structure Fraction
Helix		0.371
turn		0.212
sheet		0.265

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG648822.1	internal	132	396-1(-)
Amino Acid sequence :
LVSGKAALLGLKLFLFGVCNTIKFMDFTLQLDHTSTVCSCFDLNLVCCRLVVDAQCSSFNHAVLARMPLFVQLLYSFPHMLERNRFGEMVFLDAPNAPISFNKGTLLHYSGHNLFCKFVH VKHGSLEKSCRR
Physicochemical properties
Number of amino acids:		132
Molecular weight:		14,902.452
Theoretical pI:		8.873
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3480
Instability index:		30.695
aromaticity		0.114
GRAVY		0.368
Secondary Structure Fraction
Helix		0.371
turn		0.212
sheet		0.265