Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648824.1 | internal | 128 | 3-386(+) |
Amino Acid sequence : | |||
DVLVSNPNPVPIPLIDINYLIESDGRKLVSGLIPDAGTIHAHGSETVKIPVTLIYDDIKSTYNDIKPGSIIPYKIKVDLIVDVPIFGRLTLPLEKTGEIPIPYKPDIDLEKIHFERFSFE ETVAILHL | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,266.395 | ||
Theoretical pI: | 4.927 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 15.660 | ||
aromaticity | 0.070 | ||
GRAVY | 0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.406 | ||
turn | 0.242 | ||
sheet | 0.188 |