Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648827.1 | 5prime_partial | 101 | 2-307(+) |
Amino Acid sequence : | |||
KSIVANGLARRCIVQVSYAIGVPEPLSVFVDTYGTGKIPDKEILKIVKENFDFRPGMISINLDLKRGGNNRFLKTAAYGHFGRDDPDFTWEVVKPLKCEKA* | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 11,284.958 | ||
Theoretical pI: | 9.201 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 6.751 | ||
aromaticity | 0.099 | ||
GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.337 | ||
turn | 0.238 | ||
sheet | 0.188 |