Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648840.1 | internal | 274 | 1-822(+) |
Amino Acid sequence : | |||
QTISVDVEDGTAWVQAGATLAQVYYKIADKTSTYGFPAGICPTVGVGGHFSGGGYGTLMRKYGLSADNIVDARIVNVDGKILNKDSMGEELFWAIRGGGGASFGIVLSWKIKLVPVPKTV TVFRIQRTLEEGATALVHKWQYIAHKLPKDLTIIGVVRKVNAKEAGKKTVQVSFSSLFLGLTKQLLPIMEQSFPELGLKPEDCTEISWRQSVPFLAEMPMNSSLSDLAINQQKMLFKSKL DCVKEPIPEIVFKKLWKMFLEVDVPVMTLIPYGG | |||
Physicochemical properties | |||
Number of amino acids: | 274 | ||
Molecular weight: | 30,084.849 | ||
Theoretical pI: | 8.961 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 43430 43555 | ||
Instability index: | 31.573 | ||
aromaticity | 0.091 | ||
GRAVY | 0.084 | ||
Secondary Structure Fraction | |||
Helix | 0.350 | ||
turn | 0.230 | ||
sheet | 0.237 |