Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG648845.1 | internal | 113 | 2-340(+) |
Amino Acid sequence : | |||
VPLDLGNRPSWYKEKVYPGNKVPVLEHNNEVKGESLDLIKYIDANFEGPSLLPDDPTKREFAEELFAYTDKFSGGVFGSLKGDGDMGAPFDHLESALQKFSDGPFFLGQFSLV | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 12,543.873 | ||
Theoretical pI: | 4.592 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
Instability index: | 33.301 | ||
aromaticity | 0.133 | ||
GRAVY | -0.424 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.301 | ||
sheet | 0.248 |